Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R2A Peptide - N-terminal region

PPP2R2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

B55A, PR52A, PR55A, B55ALPHA, PR55alpha

UniProt

P63151

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP2R2A Rabbit Polyclonal Antibody (orb327257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002708

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCE1 (NM_001032279) Human Over-expression Lysate
LY422291 100 µg

RCE1 (NM_001032279) Human Over-expression Lysate

Sign In for Pricing
View Details
Flufenpyr
TRC-F498675-50MG 50 mg

Flufenpyr

Sign In for Pricing
View Details
Frozen Tissue Sections, Bone
CS501642 5x 5 µm

Frozen Tissue Sections, Bone

Sign In for Pricing
View Details
Dodine
TRC-D525600-500MG 500 mg

Dodine

Sign In for Pricing
View Details
LPP (NM_005578) Human Recombinant Protein
TP324539M 100 µg

LPP (NM_005578) Human Recombinant Protein

Sign In for Pricing
View Details
Methionine Aminopeptidase 2 Antibody
KC-8189-01 50 μL

Methionine Aminopeptidase 2 Antibody

Sign In for Pricing
View Details