PPP2R2A Peptide - N-terminal region
PPP2R2A Peptide - N-terminal region
Product Specifications
Product Name Alternative
B55A, PR52A, PR55A, B55ALPHA, PR55alpha
UniProt
P63151
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP2R2A Rabbit Polyclonal Antibody (orb327257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002708
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFAN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C1]](https://cdn.genprice.uk/products/937/68dd1b75061270361ea1a149/imageurl/ta800438bm.webp)
TA800438BM 100 µL
DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C1]
Sign In for Pricing
View Details 
AP02309PU-S 50 µL
GSK3 alpha (GSK3A) pSer21 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
