Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF31 Peptide - C-terminal region

PRPF31 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11, PRP31, SNRNP61, NY-BR-99

UniProt

Q8WWY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPF31 Rabbit Polyclonal Antibody (orb327260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006726372

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBQLNL Rabbit Polyclonal Antibody
TA383050 100 µL

UBQLNL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR562072 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
HSP27 (HSPB1) (C-term) Rabbit Polyclonal Antibody
AP23333PU-N 100 µg

HSP27 (HSPB1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL6 (NM_001024662) Human Over-expression Lysate
LY422528 100 µg

RPL6 (NM_001024662) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha-Aleuritic Acid
TRC-A525500-10G 10 g

Alpha-Aleuritic Acid

Sign In for Pricing
View Details
SHISA3 (C-term) Rabbit Polyclonal Antibody
AP53910PU-N 400 µL

SHISA3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details