Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF31 Peptide - C-terminal region

PRPF31 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11, PRP31, SNRNP61, NY-BR-99

UniProt

Q8WWY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPF31 Rabbit Polyclonal Antibody (orb327260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006726372

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB508587 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Protein A Horseradish Peroxidase
HP-02-2 2 mg

Protein A Horseradish Peroxidase

Sign In for Pricing
View Details
UNKL Polyclonal Antibody
E-AB-18961-01 20 µL

UNKL Polyclonal Antibody

Sign In for Pricing
View Details
UNKL Polyclonal Antibody
E-AB-18961-02 60 µL

UNKL Polyclonal Antibody

Sign In for Pricing
View Details
UNKL Polyclonal Antibody
E-AB-18961-03 120 µL

UNKL Polyclonal Antibody

Sign In for Pricing
View Details
UNKL Polyclonal Antibody
E-AB-18961-04 200 µL

UNKL Polyclonal Antibody

Sign In for Pricing
View Details