RAB6B Peptide - C-terminal region
RAB6B Peptide - C-terminal region
Product Specifications
Product Name Alternative
RAB6B
UniProt
Q9NRW1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAB6B Rabbit Polyclonal Antibody (orb588153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057661
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-C4a-Hu-01 96 Tests
Human Complement Component 4a (C4a) ELISA Kit
Sign In for Pricing
View Details RD-C4a-Hu-02 48 Tests
Human Complement Component 4a (C4a) ELISA Kit
Sign In for Pricing
View Details 
LY426204 100 µg
GPR172B (SLC52A1) (NM_001104577) Human Over-expression Lysate
Sign In for Pricing
View Details 
