RAB6B Peptide - C-terminal region
RAB6B Peptide - C-terminal region
Product Specifications
Product Name Alternative
RAB6B
UniProt
Q9NRW1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAB6B Rabbit Polyclonal Antibody (orb588153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057661
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]](https://cdn.genprice.uk/products/763/68dd14a6061270361e7d1a23/imageurl/e-ab-f1050m1.webp)
E-AB-F1050M1-01 20 Tests
Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]
Sign In for Pricing
View Details E-AB-F1050M1-02 100 Tests
Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]
Sign In for Pricing
View Details E-AB-F1050M1-03 2x 100 Tests
Elab Fluor® 700 Anti-Human CD31 Antibody[158-2B3]
Sign In for Pricing
View Details 
E-UNEL-H0248-01 5x 96 Tests
Uncoated Human DKK1 (Dickkopf Related Protein 1) ELISA Kit
Sign In for Pricing
View Details