Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASA1 Peptide - N-terminal region

RASA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RASA1, GAP, RASA

UniProt

P20936

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASA1 Rabbit Polyclonal Antibody (orb588156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF (NM_000601) Human Recombinant Protein
TP315593M 100 µg

HGF (NM_000601) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Sycn activation kit by CRISPRa
GA207805 1 Kit

Mouse Sycn activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC113 Human Gene Knockout Kit (CRISPR)
KN419667 1 Kit

CCDC113 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgG (Fc specific) Mouse Monoclonal Antibody [Clone ID: 4A10]
AM06320SU-N 100 µL

Human IgG (Fc specific) Mouse Monoclonal Antibody [Clone ID: 4A10]

Sign In for Pricing
View Details
Guanosine-13C5 5'-Monophosphate
TRC-G838514-5MG 5 mg

Guanosine-13C5 5'-Monophosphate

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS712396 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details