RASA1 Peptide - N-terminal region
RASA1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RASA1, GAP, RASA
UniProt
P20936
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASA1 Rabbit Polyclonal Antibody (orb588156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681846-100 1x 100 µL
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSM040303 50 µg
Recombinant Mouse CHK2/CHEK2 Protein (His & GST Tag)
Sign In for Pricing
View Details 
MTW06F4-PA 10x 96 Well Plates
Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
Sign In for Pricing
View Details 