Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKMT2 Peptide - N-terminal region

CKMT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SMTCK

UniProt

P17540

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKMT2 Rabbit Polyclonal Antibody (orb327291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001816

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camfetamine Hydrochloride
TRC-C150050-5MG 5 mg

Camfetamine Hydrochloride

Sign In for Pricing
View Details
ADGRB1 Antibody (Biotin)
KB-8281-01 50 μL

ADGRB1 Antibody (Biotin)

Sign In for Pricing
View Details
ADGRB1 Antibody (Biotin)
KB-8281-02 100 µL

ADGRB1 Antibody (Biotin)

Sign In for Pricing
View Details
ADGRB1 Antibody (Biotin)
KB-8281-03 1 mL

ADGRB1 Antibody (Biotin)

Sign In for Pricing
View Details
MPST (NM_001130517) Human Recombinant Protein
TP325408L 1 mg

MPST (NM_001130517) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Cacna1a activation kit by CRISPRa
GA200475 1 Kit

Mouse Cacna1a activation kit by CRISPRa

Sign In for Pricing
View Details