Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKMT2 Peptide - N-terminal region

CKMT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SMTCK

UniProt

P17540

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKMT2 Rabbit Polyclonal Antibody (orb327291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001816

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdkn2c (NM_007671) Mouse Tagged ORF Clone
MG201381 10 µg

Cdkn2c (NM_007671) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
URG4 (URGCP) (Center) Rabbit Polyclonal Antibody
AP54482PU-N 400 µL

URG4 (URGCP) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Glucosidase 2 subunit beta Antibody
RC-16490-01 50 μL

Recombinant Glucosidase 2 subunit beta Antibody

Sign In for Pricing
View Details
Recombinant Glucosidase 2 subunit beta Antibody
RC-16490-02 100 µL

Recombinant Glucosidase 2 subunit beta Antibody

Sign In for Pricing
View Details
Recombinant Glucosidase 2 subunit beta Antibody
RC-16490-03 1 mL

Recombinant Glucosidase 2 subunit beta Antibody

Sign In for Pricing
View Details
GOLGA6D Human Gene Knockout Kit (CRISPR)
KN426747 1 Kit

GOLGA6D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details