Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF3B Peptide - C-terminal region

KIF3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIF3B, KIAA0359

UniProt

O15066

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF3B Rabbit Polyclonal Antibody (orb588393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004789

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Ethyl-2 (1H) -pyridinone
E14600 50 mg

1-Ethyl-2 (1H) -pyridinone

Sign In for Pricing
View Details
Sex Hormone Binding GlobuLin (SHBG) (NM_001040) Human Over-expression Lysate
LC421869 20 µg

Sex Hormone Binding GlobuLin (SHBG) (NM_001040) Human Over-expression Lysate

Sign In for Pricing
View Details
MNAT1 Polyclonal Antibody, HRP Conjugated
bs-7896R-HRP 100 µL

MNAT1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
TPD52L1 siRNA (Mouse)
CRM4218-01 15 nmol

TPD52L1 siRNA (Mouse)

Sign In for Pricing
View Details
TPD52L1 siRNA (Mouse)
CRM4218-02 30 nmol

TPD52L1 siRNA (Mouse)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Bone Morphogenetic Protein 2 (BMP2)
TRV-0021393-01 200 µL

Biotin-Linked Polyclonal Antibody to Bone Morphogenetic Protein 2 (BMP2)

Sign In for Pricing
View Details