Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF3B Peptide - C-terminal region

KIF3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIF3B, KIAA0359

UniProt

O15066

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF3B Rabbit Polyclonal Antibody (orb588393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004789

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IgA Antibody (HISA43) [DyLight 405]
NBP3-11510V 0.1 mL

Mouse Monoclonal IgA Antibody (HISA43) [DyLight 405]

Sign In for Pricing
View Details
Mannioside A
TN4493 1 mg

Mannioside A

Sign In for Pricing
View Details
USP7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C7]
TA504064AM 100 µL

USP7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C7]

Sign In for Pricing
View Details
Troponin I Type 1, Slow Skeletal (TNNI1) Monoclonal Antibody
CAU29879-01 100 µL

Troponin I Type 1, Slow Skeletal (TNNI1) Monoclonal Antibody

Sign In for Pricing
View Details
Troponin I Type 1, Slow Skeletal (TNNI1) Monoclonal Antibody
CAU29879-02 200 µL

Troponin I Type 1, Slow Skeletal (TNNI1) Monoclonal Antibody

Sign In for Pricing
View Details
Mycophenolic Acid-d3
TRC-M831502-10MG 10 mg

Mycophenolic Acid-d3

Sign In for Pricing
View Details