Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF5 Peptide - C-terminal region

KLF5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLF5, BTEB2, CKLF, IKLF

UniProt

Q13887

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLF5 Rabbit Polyclonal Antibody (orb588397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001721

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERVV-1 Human Gene Knockout Kit (CRISPR)
KN431263 1 Kit

ERVV-1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559560 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
NRG1 Human Gene Knockout Kit (CRISPR)
KN211372LP 1 Kit

NRG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C9orf115 (PTRH1) (NM_001002913) Human Over-expression Lysate
LY424109 100 µg

C9orf115 (PTRH1) (NM_001002913) Human Over-expression Lysate

Sign In for Pricing
View Details
Valproic Acid
TRC-V094750-1G 1 g

Valproic Acid

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), 0.2mg/mL
BNUB2475-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), 0.2mg/mL

Sign In for Pricing
View Details