Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF5 Peptide - C-terminal region

KLF5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLF5, BTEB2, CKLF, IKLF

UniProt

Q13887

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLF5 Rabbit Polyclonal Antibody (orb588397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001721

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ferritin, Mitochondrial (FTMT) ELISA Kit
RDR-FTMT-Hu-01 96 Tests

Human Ferritin, Mitochondrial (FTMT) ELISA Kit

Sign In for Pricing
View Details
Human Ferritin, Mitochondrial (FTMT) ELISA Kit
RDR-FTMT-Hu-02 48 Tests

Human Ferritin, Mitochondrial (FTMT) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS807782 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
DAZ2 (C-term) Rabbit Polyclonal Antibody
AP51186PU-N 400 µL

DAZ2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (BE2.1), CF640R conjugate, 0.1mg/mL
BNC402321-500 1x 500 µL

Calcineurin B / PPP3R1 (BE2.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LTA4H Recombinant Rabbit Monoclonal Antibody [JE52-14]
ET7110-13 100 µL

LTA4H Recombinant Rabbit Monoclonal Antibody [JE52-14]

Sign In for Pricing
View Details