Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAPK3 Peptide - C-terminal region

DAPK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAPK3, ZIPK

UniProt

O43293

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAPK3 Rabbit Polyclonal Antibody (orb588400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005259566

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MES Buffer 0.5M, pH 9.0
41320084-2 250 mL

MES Buffer 0.5M, pH 9.0

Sign In for Pricing
View Details
TLN1 Antibody, FITC conjugated
CSB-PA05189C0Rb-01 50 µg

TLN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
TLN1 Antibody, FITC conjugated
CSB-PA05189C0Rb-02 100 µg

TLN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
CD40LG Recombinant Protein N-6His-Avi Tag Lyophilized 20ug
IHUCD40LGRN6HISAVILY20UG 20 µg

CD40LG Recombinant Protein N-6His-Avi Tag Lyophilized 20ug

Sign In for Pricing
View Details
CYP19A1 Antibody
orb864051 2 mg

CYP19A1 Antibody

Sign In for Pricing
View Details
Trypsin-EDTA, 0.25% 1X, without Calcium, Magnesium
CCM2042-500 500 mL

Trypsin-EDTA, 0.25% 1X, without Calcium, Magnesium

Sign In for Pricing
View Details