Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAPK3 Peptide - C-terminal region

DAPK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAPK3, ZIPK

UniProt

O43293

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAPK3 Rabbit Polyclonal Antibody (orb588400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005259566

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab27a Rabbit Polyclonal Antibody (BF488)
orb2504327 100 µL

Rab27a Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Rabbit anti-e1F2A Antibody, Affinity Purified
A301-949A 20 µg

Rabbit anti-e1F2A Antibody, Affinity Purified

Sign In for Pricing
View Details
2- (3,3-Difluoropiperidin-4-yl) acetonitrile
HWC51655-01 50 mg

2- (3,3-Difluoropiperidin-4-yl) acetonitrile

Sign In for Pricing
View Details
2- (3,3-Difluoropiperidin-4-yl) acetonitrile
HWC51655-02 0.5 g

2- (3,3-Difluoropiperidin-4-yl) acetonitrile

Sign In for Pricing
View Details
Frmpd4 3'UTR Luciferase Stable Cell Line
TU106740 1.0 mL

Frmpd4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Protein L - 100nm Gold Conjugate
AC-100-19 1 mL

Protein L - 100nm Gold Conjugate

Sign In for Pricing
View Details