Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2D Peptide - N-terminal region

EIF2D Peptide - N-terminal region

Product Specifications

Product Name Alternative

EIF2D, HCA56, LGTN

UniProt

P41214

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2D Rabbit Polyclonal Antibody (orb588401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008824

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNKSSPPSIAPLALDSA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ammonium sodium hydrogen phosphate
OR1066713-01 25 g

Ammonium sodium hydrogen phosphate

Sign In for Pricing
View Details
Ammonium sodium hydrogen phosphate
OR1066713-02 100 g

Ammonium sodium hydrogen phosphate

Sign In for Pricing
View Details
Ammonium sodium hydrogen phosphate
OR1066713-03 500 g

Ammonium sodium hydrogen phosphate

Sign In for Pricing
View Details
NSF (NM_006178) Human Over-expression Lysate
LH18573V 100 µg

NSF (NM_006178) Human Over-expression Lysate

Sign In for Pricing
View Details
EasyStep Human PSMA (Prostate specific membrane antigen) ELISA Kit
MBS8821021-01 64 Tests

EasyStep Human PSMA (Prostate specific membrane antigen) ELISA Kit

Sign In for Pricing
View Details
EasyStep Human PSMA (Prostate specific membrane antigen) ELISA Kit
MBS8821021-02 112 Tests

EasyStep Human PSMA (Prostate specific membrane antigen) ELISA Kit

Sign In for Pricing
View Details