Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2D Peptide - N-terminal region

EIF2D Peptide - N-terminal region

Product Specifications

Product Name Alternative

EIF2D, HCA56, LGTN

UniProt

P41214

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2D Rabbit Polyclonal Antibody (orb588401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008824

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNKSSPPSIAPLALDSA

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM50 Rabbit Polyclonal Antibody
orb575117 100 µL

TRIM50 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdk1/2 Inhibitor II, NU6102
USA72295-01 10 mg

Cdk1/2 Inhibitor II, NU6102

Sign In for Pricing
View Details
Cdk1/2 Inhibitor II, NU6102
USA72295-02 25 mg

Cdk1/2 Inhibitor II, NU6102

Sign In for Pricing
View Details
Cdk1/2 Inhibitor II, NU6102
USA72295-03 50 mg

Cdk1/2 Inhibitor II, NU6102

Sign In for Pricing
View Details
PTP4A3 Human shRNA Plasmid Kit (Locus ID 11156)
TL320652 1 Kit

PTP4A3 Human shRNA Plasmid Kit (Locus ID 11156)

Sign In for Pricing
View Details
COX7B Recombinant Protein (Human)
RP007807 100 µg

COX7B Recombinant Protein (Human)

Sign In for Pricing
View Details