Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2D Peptide - N-terminal region

EIF2D Peptide - N-terminal region

Product Specifications

Product Name Alternative

EIF2D, HCA56, LGTN

UniProt

P41214

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2D Rabbit Polyclonal Antibody (orb588402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008824

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1632808 1.0 µg DNA

PGAM2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NPY4R Polyclonal Antibody, PerCP Conjugated
bs-11522R-PerCP 100 µL

NPY4R Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Mouse Polyclonal PPEF1 Antibody
H00005475-B01P 0.05 mg

Mouse Polyclonal PPEF1 Antibody

Sign In for Pricing
View Details
FGR (NM_001042747) Human Tagged ORF Clone Lentiviral Particle
RC215016L1V 200 µL

FGR (NM_001042747) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ANKAR CRISPR/Cas9 KO Plasmid (h)
sc-414687 20 µg

ANKAR CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Porcine Interleukin 1 Alpha ELISA Kit
MBS7277293-01 48 Well

Porcine Interleukin 1 Alpha ELISA Kit

Sign In for Pricing
View Details