Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2D Peptide - N-terminal region

EIF2D Peptide - N-terminal region

Product Specifications

Product Name Alternative

EIF2D, HCA56, LGTN

UniProt

P41214

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF2D Rabbit Polyclonal Antibody (orb588402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008824

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC42 (NM_052940) Human Tagged ORF Clone
RG201955 10 µg

LRRC42 (NM_052940) Human Tagged ORF Clone

Sign In for Pricing
View Details
MEHMO CRISPR Knock Out 293T Cell Line (Human)
28337141 1x 10^6 Cells / 1.0 mL

MEHMO CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ZIK1 Rabbit Polyclonal Antibody (AP)
orb958821 100 µL

ZIK1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Sheep Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit
MBS9349499-01 48 Well

Sheep Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit

Sign In for Pricing
View Details
Sheep Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit
MBS9349499-02 96 Well

Sheep Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit

Sign In for Pricing
View Details
Sheep Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit
MBS9349499-03 5x 96 Well

Sheep Disrupted In Renal Carcinoma Protein 2 (DIRC2) ELISA Kit

Sign In for Pricing
View Details