Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAD2 Peptide - N-terminal region

GAD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GAD65

UniProt

Q05329

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAD2 Rabbit Polyclonal Antibody (orb327312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001127838

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tide Quencher™ 5.1 CPG [TQ5.1 CPG] *1000 Å*
2085-AAT 100 mg

Tide Quencher™ 5.1 CPG [TQ5.1 CPG] *1000 Å*

Sign In for Pricing
View Details
Human ZDHHC24 activation kit by CRISPRa
GA116784 1 Kit

Human ZDHHC24 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Iodopropane (Stabilized with Copper)
TRC-I718795-1G 1 g

2-Iodopropane (Stabilized with Copper)

Sign In for Pricing
View Details
Mmp14 Mouse Gene Knockout Kit (CRISPR)
KN310167BN 1 Kit

Mmp14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(3S,4R)-Cabastine Hydrochloride
TRC-C045500-25MG 25 mg

(3S,4R)-Cabastine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631540 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details