Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAD2 Peptide - N-terminal region

GAD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GAD65

UniProt

Q05329

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAD2 Rabbit Polyclonal Antibody (orb327312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001127838

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-2-Microglobulin (B2M) (B2M/1118), CF488A conjugate, 0.1mg/mL
BNC881118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MARK2 Rabbit Polyclonal Antibody
TA368095 100 µL

MARK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL
BNC472052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4H10]
CF812456 100 µg

MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4H10]

Sign In for Pricing
View Details
2,3-Dihydroxy-4-oxopentanoic Acid
TRC-D453920-25MG 25 mg

2,3-Dihydroxy-4-oxopentanoic Acid

Sign In for Pricing
View Details
EHD3 Rabbit Polyclonal Antibody
AP14106PU-N 400 µL

EHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details