HNRNPL Peptide - middle region
HNRNPL Peptide - middle region
Product Specifications
Product Name Alternative
HNRPL, hnRNP-L, P/OKcl.14
UniProt
P14866
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HNRNPL Rabbit Polyclonal Antibody (orb588408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001524
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EK17357 48 Tests
Human Zinc Finger, AN1-Type Domain Protein 6 (ZFAND6) ELISA Kit
Sign In for Pricing
View Details ![Mouse Monoclonal Seasonal H1N1 Hemagglutinin Antibody (7H12F6) [Alexa Fluor 405]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-41328AF405 0.1 mL
Mouse Monoclonal Seasonal H1N1 Hemagglutinin Antibody (7H12F6) [Alexa Fluor 405]
Sign In for Pricing
View Details 120600I0-AAT 100 Tests
IFluor® 680 Anti-human CD206 Antibody *15-2*
Sign In for Pricing
View Details