Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPL Peptide - middle region

HNRNPL Peptide - middle region

Product Specifications

Product Name Alternative

HNRPL, hnRNP-L, P/OKcl.14

UniProt

P14866

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPL Rabbit Polyclonal Antibody (orb588408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001524

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXLNA 293 Cell Lysate
403851 0.1 mg

TXLNA 293 Cell Lysate

Sign In for Pricing
View Details
SNAP 23 (D-11) PE
sc-374215 PE 200 µg/mL

SNAP 23 (D-11) PE

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042203-01 0.02 mg

ATP synthase subunit b

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042203-02 0.1 mg

ATP synthase subunit b

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042203-03 5x 0.1 mg

ATP synthase subunit b

Sign In for Pricing
View Details
Perfluoro (2-ethoxyethane) sulphonic acid
sc-264023B 5 g

Perfluoro (2-ethoxyethane) sulphonic acid

Sign In for Pricing
View Details