Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1A Peptide - N-terminal region

HSPA1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSP72, HSPA1, HSP70I, HSP70-1, HSP70-2, HSP70.1, HSP70.2, HSP70-1A, HEL-S-103

UniProt

P08107

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA1A Rabbit Polyclonal Antibody (orb588410) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005337

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf166 siRNA (h)
sc-72716 10 µM

C20orf166 siRNA (h)

Sign In for Pricing
View Details
SVCT1 Double Nickase Plasmid (h2)
sc-403006-NIC-2 20 µg

SVCT1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
AEBSF Hydrochloride
A0910-01 50 mg

AEBSF Hydrochloride

Sign In for Pricing
View Details
AEBSF Hydrochloride
A0910-02 100 mg

AEBSF Hydrochloride

Sign In for Pricing
View Details
AEBSF Hydrochloride
A0910-03 500 mg

AEBSF Hydrochloride

Sign In for Pricing
View Details
AEBSF Hydrochloride
A0910-04 1 g

AEBSF Hydrochloride

Sign In for Pricing
View Details