HSPA1A Peptide - N-terminal region
HSPA1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
HSP72, HSPA1, HSP70I, HSP70-1, HSP70-2, HSP70.1, HSP70.2, HSP70-1A, HEL-S-103
UniProt
P08107
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPA1A Rabbit Polyclonal Antibody (orb588410) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005337
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15151455 1 Vial
Lentiviral human SUPT20HL2 shRNA (UAS) - Lentiviral human SUPT20HL2 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
A04213-1-Biotin 100 µg/Vial
Anti-NEU3 Antibody Picoband® Biotin Conjugated
Sign In for Pricing
View Details MBS1143108 Inquire
Recombinant Streptococcus uberis Proline--tRNA ligase (proS), partial
Sign In for Pricing
View Details 