KIT Peptide - middle region
KIT Peptide - middle region
Product Specifications
Product Name Alternative
KIT, SCFR
UniProt
P10721
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIT Rabbit Polyclonal Antibody (orb588411) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6193154-01 0.1 mL
TRADD (Tumor Necrosis Factor Receptor Type 1-associated DEATH Domain Protein, TNFR1-associated DEATH Domain Protein, TNFRSF1A-associated Via Death Domain) (MaxLight 405)
Sign In for Pricing
View Details MBS6193154-02 5x 0.1 mL
TRADD (Tumor Necrosis Factor Receptor Type 1-associated DEATH Domain Protein, TNFR1-associated DEATH Domain Protein, TNFRSF1A-associated Via Death Domain) (MaxLight 405)
Sign In for Pricing
View Details 
MBS8126483-01 0.1 mL
Anti-Cyclin A2/CCNA2 Antibody, Rabbit Polyclonal
Sign In for Pricing
View Details