Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC1 Peptide - N-terminal region

KLC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KLC1, KLC, KNS2

UniProt

Q07866

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLC1 Rabbit Polyclonal Antibody (orb588412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_891553

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (H+L) (Neuronal Marker) (2F11), CF568 conjugate, 0.1mg/mL
BNC683912-100 1x 100 µL

Neurofilament (H+L) (Neuronal Marker) (2F11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myelin Basic Protein (MBP) (NM_001025090) Human Over-expression Lysate
LC422582 20 µg

Myelin Basic Protein (MBP) (NM_001025090) Human Over-expression Lysate

Sign In for Pricing
View Details
hnRNP L (HNRNPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F11]
TA805577BM 100 µL

hnRNP L (HNRNPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS641428 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
THAP4 Antibody
8C19099-AAT 50 µg

THAP4 Antibody

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]
TA504871BM 100 µL

SENP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details