Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC1 Peptide - N-terminal region

KLC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KLC1, KLC, KNS2

UniProt

Q07866

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLC1 Rabbit Polyclonal Antibody (orb588412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_891553

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEpsilon-(1-Carboxyethyl)-L-lysine(Mixture of Diastereomers)
TRC-C178070-10MG 10 mg

NEpsilon-(1-Carboxyethyl)-L-lysine(Mixture of Diastereomers)

Sign In for Pricing
View Details
ASXL2 Human Gene Knockout Kit (CRISPR)
KN420364 1 Kit

ASXL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF647 conjugate, 0.1mg/mL
BNC471388-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p16INK4A (CDKN2A) (NM_000077) Human Recombinant Protein
TP320937 20 µg

p16INK4A (CDKN2A) (NM_000077) Human Recombinant Protein

Sign In for Pricing
View Details
5-Oxo-1,3-dioxolane-4,4-diacetic Acid
TRC-O855500-1G 1 g

5-Oxo-1,3-dioxolane-4,4-diacetic Acid

Sign In for Pricing
View Details
PE/Cyanine5 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832G-01 20 Tests

PE/Cyanine5 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details