SPEF1 Peptide - N-terminal region
SPEF1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SPEF1, C20orf28
UniProt
Q9Y4P9
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPEF1 Rabbit Polyclonal Antibody (orb588494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056232
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471832-100 1x 100 µL
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742480-100 1x 100 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![TDP43 Recombinant Rabbit Monoclonal Antibody [PSH09-14]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea82528/imageurl/ha723072.webp)
HA723072 100 µL
TDP43 Recombinant Rabbit Monoclonal Antibody [PSH09-14]
Sign In for Pricing
View Details