SPEF1 Peptide - N-terminal region
SPEF1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SPEF1, C20orf28
UniProt
Q9Y4P9
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPEF1 Rabbit Polyclonal Antibody (orb588494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056232
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MOK protein kinase (MOK) Mouse Monoclonal Antibody [Clone ID: OTI9G8]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9089a9/imageurl/cf810869.webp)
CF810869 100 µg
MOK protein kinase (MOK) Mouse Monoclonal Antibody [Clone ID: OTI9G8]
Sign In for Pricing
View Details 
E-EL-H2101-01 24 Tests
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
Sign In for Pricing
View Details E-EL-H2101-02 48 Tests
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
Sign In for Pricing
View Details E-EL-H2101-03 96 Tests
Human PAP (Plasmin-Antiplasmin Complex) ELISA Kit
Sign In for Pricing
View Details 
TRC-N427510-250MG 250 mg
(1’S,2'S)-Nicotine 1'-Oxide and (1’R,2'S)-Nicotine 1'-Oxide Mixture
Sign In for Pricing
View Details