Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IBTK Peptide - C-terminal region

IBTK Peptide - C-terminal region

Product Specifications

Product Name Alternative

IBTK, BTKI, KIAA1417

UniProt

Q9P2D0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IBTK Rabbit Polyclonal Antibody (orb588497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056340

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDIFLKEEINMEQNHSETMFKKAKTKAKKKPRKRSDSSGGYNLSDIIQSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm5458 ORF Vector (Mouse) (pORF)
22096014 1.0 µg DNA

Gm5458 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
V1ra14 CRISPRa sgRNA lentivector (set of three targets)(Rat)
49407126 3x 1.0µg DNA

V1ra14 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Tumor Necrosis Factor alpha (TNF-α)
EL10019 96 Well

Tumor Necrosis Factor alpha (TNF-α)

Sign In for Pricing
View Details
Recombinant Enterobacter sp. Autoinducer 2 import system permease protein lsrD (lsrD), partial
MBS1176183-01 1 mg (E-Coli)

Recombinant Enterobacter sp. Autoinducer 2 import system permease protein lsrD (lsrD), partial

Sign In for Pricing
View Details
Recombinant Enterobacter sp. Autoinducer 2 import system permease protein lsrD (lsrD), partial
MBS1176183-02 1 mg (Yeast)

Recombinant Enterobacter sp. Autoinducer 2 import system permease protein lsrD (lsrD), partial

Sign In for Pricing
View Details
Human Putative uncharacterized protein C1orf180 (LINC01555) ELISA Kit
abx504441 96 Tests

Human Putative uncharacterized protein C1orf180 (LINC01555) ELISA Kit

Sign In for Pricing
View Details