Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IBTK Peptide - C-terminal region

IBTK Peptide - C-terminal region

Product Specifications

Product Name Alternative

IBTK, BTKI, KIAA1417

UniProt

Q9P2D0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IBTK Rabbit Polyclonal Antibody (orb588497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056340

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDIFLKEEINMEQNHSETMFKKAKTKAKKKPRKRSDSSGGYNLSDIIQSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fusion glycoprotein F0, Measles virus (Cell-Free, His, Avi)
HY-P702282 Inquire

Fusion glycoprotein F0, Measles virus (Cell-Free, His, Avi)

Sign In for Pricing
View Details
MBLAC2 Double Nickase Plasmid (h2)
sc-406416-NIC-2 20 µg

MBLAC2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Benzocaine N-b-D-glucoside
MB08214-01 50 mg

Benzocaine N-b-D-glucoside

Sign In for Pricing
View Details
Benzocaine N-b-D-glucoside
MB08214-02 100 mg

Benzocaine N-b-D-glucoside

Sign In for Pricing
View Details
Benzocaine N-b-D-glucoside
MB08214-03 250 mg

Benzocaine N-b-D-glucoside

Sign In for Pricing
View Details
Benzocaine N-b-D-glucoside
MB08214-04 500 mg

Benzocaine N-b-D-glucoside

Sign In for Pricing
View Details