Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSMF Peptide - N-terminal region

NSMF Peptide - N-terminal region

Product Specifications

Product Name Alternative

NSMF, NELF

UniProt

Q6X4W1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSMF Rabbit Polyclonal Antibody (orb327366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQSHPENRNGADHLLADAYSGHDGSPEMQPAPQNKRRLSLVSNGCYEGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-Ra-01 96 Tests

Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-Ra-02 48 Tests

Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
Anti-Mouse CD120a (55R-593) In Vivo Antibody - Low Endotoxin
ICH1069-25mg 25 mg

Anti-Mouse CD120a (55R-593) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Arylex
TRC-A794890-1MG 1 mg

Arylex

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708097 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
MYD88 Rabbit Polyclonal Antibody
TA384825 100 µL

MYD88 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details