Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17F Peptide - N-terminal region

IL17F Peptide - N-terminal region

Product Specifications

Product Name Alternative

IL17F

UniProt

Q96PD4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL17F Rabbit Polyclonal Antibody (orb573652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_443104

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem154 (NM_177260) Mouse Tagged ORF Clone
MG201637 10 µg

Tmem154 (NM_177260) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Blocks, Skin
CB602711 1 Block

Frozen Tissue Blocks, Skin

Sign In for Pricing
View Details
Single Frequency type Ultrasonic Cleaner BULC-708
BULC-708 Each

Single Frequency type Ultrasonic Cleaner BULC-708

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G7]
TA500623AM 100 µL

Carbonic Anhydrase IX (CA9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G7]

Sign In for Pricing
View Details
Human C1orf223 (TEX38) activation kit by CRISPRa
GA117798 1 Kit

Human C1orf223 (TEX38) activation kit by CRISPRa

Sign In for Pricing
View Details
Shipping Accessories Kit
38300 50 Preparations

Shipping Accessories Kit

Sign In for Pricing
View Details