Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17F Peptide - N-terminal region

IL17F Peptide - N-terminal region

Product Specifications

Product Name Alternative

IL17F

UniProt

Q96PD4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL17F Rabbit Polyclonal Antibody (orb573652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_443104

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant p73 Antibody
RC-6878-01 50 μL

Recombinant p73 Antibody

Sign In for Pricing
View Details
Recombinant p73 Antibody
RC-6878-02 100 µL

Recombinant p73 Antibody

Sign In for Pricing
View Details
Recombinant p73 Antibody
RC-6878-03 1 mL

Recombinant p73 Antibody

Sign In for Pricing
View Details
S100B (S100B/1012), CF740 conjugate, 0.1mg/mL
BNC741012-100 1x 100 µL

S100B (S100B/1012), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMP PNP (~90%)
TRC-A634303-2.5MG 2.5 mg

AMP PNP (~90%)

Sign In for Pricing
View Details
Recombinant PRKCQ Antibody
RC-5866-01 50 μL

Recombinant PRKCQ Antibody

Sign In for Pricing
View Details