Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX3 Peptide - C-terminal region

PAX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAX3, HUP2

UniProt

P23760

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX3 Rabbit Polyclonal Antibody (orb574033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_852126

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVPFIISSQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP1 Maleimide
20341-AAT 100 µg

IP1 Maleimide

Sign In for Pricing
View Details
MerTK (Innate Immune Checkpoint) (MERTK/3022), CF568 conjugate, 0.1mg/mL
BNC683022-500 1x 500 µL

MerTK (Innate Immune Checkpoint) (MERTK/3022), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAC1 Human Gene Knockout Kit (CRISPR)
KN208711RB 1 Kit

RAC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS626105 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Anxa1 Mouse Gene Knockout Kit (CRISPR)
KN501330 1 Kit

Anxa1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TGIF (TGIF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]
TA802287AM 100 µL

TGIF (TGIF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details