Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX3 Peptide - C-terminal region

PAX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAX3, HUP2

UniProt

P23760

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX3 Rabbit Polyclonal Antibody (orb574033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_852126

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVPFIISSQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abietic Acid, >95%
TRC-A108203-1G 1 g

Abietic Acid, >95%

Sign In for Pricing
View Details
OLFML2B Antibody
8G485-AAT 50 µg

OLFML2B Antibody

Sign In for Pricing
View Details
ICAM1 Recombinant Rabbit monoclonal Antibody
HA751605 100 µL

ICAM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PTPD1 (PTPN21) (Center) Rabbit Polyclonal Antibody
AP15233PU-N 400 µL

PTPD1 (PTPN21) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SAR131675
TRC-S139510-50MG 50 mg

SAR131675

Sign In for Pricing
View Details
NoV TaqMan Probe/Primer and Control Set
TM41410 100 Reactions

NoV TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details