Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF24 Peptide - N-terminal region

ZNF24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF24, KOX17, ZNF191, ZSCAN3

UniProt

P17028

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF24 Rabbit Polyclonal Antibody (orb574705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR5194 Protein Vector (Human) (pPB-C-His)
PV098938 500 ng

MIR5194 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
FucT-IV CRISPR Activation Plasmid (h)
sc-401795-ACT 20 µg

FucT-IV CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
CDNF siRNA (Human)
MBS8206023-01 15 nmol

CDNF siRNA (Human)

Sign In for Pricing
View Details
CDNF siRNA (Human)
MBS8206023-02 30 nmol

CDNF siRNA (Human)

Sign In for Pricing
View Details
CDNF siRNA (Human)
MBS8206023-03 5x 30 nmol

CDNF siRNA (Human)

Sign In for Pricing
View Details
INPP4B Antibody
OC-523-01 50 μL

INPP4B Antibody

Sign In for Pricing
View Details