Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF24 Peptide - N-terminal region

ZNF24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF24, KOX17, ZNF191, ZSCAN3

UniProt

P17028

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF24 Rabbit Polyclonal Antibody (orb574705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXW11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20350111 3x 1.0 µg

FBXW11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Raet1e 3'UTR Lenti-reporter-Luc Vector
38440086 1.0 µg

Raet1e 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CACNA2D2 Protein Vector (Mouse) (pPM-C-His)
PV160873 500 ng

CACNA2D2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CD34 Polyclonal Antibody, HRP Conjugated
bs-0646R-HRP-01 20 µL

CD34 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
CD34 Polyclonal Antibody, HRP Conjugated
bs-0646R-HRP-02 100 µL

CD34 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Myostatin (MSTN)
MBS2086787-01 0.01 mg

Recombinant Myostatin (MSTN)

Sign In for Pricing
View Details