Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNIP1 Peptide - C-terminal region

SNIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SNIP1

UniProt

Q8TAD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNIP1 Rabbit Polyclonal Antibody (orb574739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_078976

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Bovine FGF6 ELISA Kit
GR112136 96 Well

Nori® Bovine FGF6 ELISA Kit

Sign In for Pricing
View Details
Rab 1B Double Nickase Plasmid (h)
sc-402021-NIC 20 µg

Rab 1B Double Nickase Plasmid (h)

Sign In for Pricing
View Details
HafnoceneDichloride
H2170 1 g

HafnoceneDichloride

Sign In for Pricing
View Details
EIF2S3 Protein (N-His, Human)
P503548 100 µg

EIF2S3 Protein (N-His, Human)

Sign In for Pricing
View Details
Mouse Monoclonal ACE-2 Antibody (1034734) [Janelia Fluor 635]
FAB10822JF635 0.1 mL

Mouse Monoclonal ACE-2 Antibody (1034734) [Janelia Fluor 635]

Sign In for Pricing
View Details
RPA4 Blocking Peptide
MBS8205878-01 1 mg

RPA4 Blocking Peptide

Sign In for Pricing
View Details