Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2C Peptide - C-terminal region

KIF2C Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIF2C, KNSL6

UniProt

Q99661

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF2C Rabbit Polyclonal Antibody (orb574879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVPR1B ORF Vector (Human) (pORF)
12883011 1.0 µg DNA

AVPR1B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Activin A Receptor type IIA antibody
70R-13585 100 ul

Activin A Receptor type IIA antibody

Sign In for Pricing
View Details
Anti-Human CD154/CD40LG/TNFSF5 Antibody (5C8), PerCP
MBS1583965-01 50 Tests

Anti-Human CD154/CD40LG/TNFSF5 Antibody (5C8), PerCP

Sign In for Pricing
View Details
Anti-Human CD154/CD40LG/TNFSF5 Antibody (5C8), PerCP
MBS1583965-02 100 Tests

Anti-Human CD154/CD40LG/TNFSF5 Antibody (5C8), PerCP

Sign In for Pricing
View Details
Anti-Human CD154/CD40LG/TNFSF5 Antibody (5C8), PerCP
MBS1583965-03 5x 100 Tests

Anti-Human CD154/CD40LG/TNFSF5 Antibody (5C8), PerCP

Sign In for Pricing
View Details
Tissue Genomic DNA, Kidney
CD563945 5 µg

Tissue Genomic DNA, Kidney

Sign In for Pricing
View Details