Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2C Peptide - C-terminal region

KIF2C Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIF2C, KNSL6

UniProt

Q99661

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF2C Rabbit Polyclonal Antibody (orb574879) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1810031K17Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10301114 3x 1.0 µg

1810031K17Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ANGPT2 Antibody
orb689098-01 50 μL

ANGPT2 Antibody

Sign In for Pricing
View Details
ANGPT2 Antibody
orb689098-02 100 µL

ANGPT2 Antibody

Sign In for Pricing
View Details
SH3GL3 Human Over-expression Lysate
orb1365639 20 µg

SH3GL3 Human Over-expression Lysate

Sign In for Pricing
View Details
MAGEC3-set siRNA/shRNA/RNAi Lentivector (Human)
27939091 4x 500 ng

MAGEC3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
IDDM16 3'UTR GFP Stable Cell Line
TU060419 1.0 mL

IDDM16 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details