ZNF614 Peptide - middle region
ZNF614 Peptide - middle region
Product Specifications
UniProt
Q8N883
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF614 Rabbit Polyclonal Antibody (orb324580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_079316
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LFTKHLKTNTTDKICIPNEYRKGSTVKSSLITHQQTHTEEKSYMCSECGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1020203-01 0.02 mg (E-Coli)
Recombinant Pantoea ananatis Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
Sign In for Pricing
View Details MBS1020203-02 0.1 mg (E-Coli)
Recombinant Pantoea ananatis Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
Sign In for Pricing
View Details MBS1020203-03 0.02 mg (Yeast)
Recombinant Pantoea ananatis Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
Sign In for Pricing
View Details MBS1020203-04 0.1 mg (Yeast)
Recombinant Pantoea ananatis Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
Sign In for Pricing
View Details MBS1020203-05 0.02 mg (Baculovirus)
Recombinant Pantoea ananatis Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
Sign In for Pricing
View Details MBS1020203-06 0.02 mg (Mammalian-Cell)
Recombinant Pantoea ananatis Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
Sign In for Pricing
View Details