Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF614 Peptide - middle region

ZNF614 Peptide - middle region

Product Specifications

UniProt

Q8N883

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF614 Rabbit Polyclonal Antibody (orb324580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079316

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFTKHLKTNTTDKICIPNEYRKGSTVKSSLITHQQTHTEEKSYMCSECGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF8 Recombinant Rabbit mAb
orb2322606-01 25 µL

PRPF8 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PRPF8 Recombinant Rabbit mAb
orb2322606-02 50 µL

PRPF8 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PRPF8 Recombinant Rabbit mAb
orb2322606-03 100 µL

PRPF8 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Recombinant Human Melanophilin Protein - (Dry Ice)
H00079083-P01-10ug 10 µg

Recombinant Human Melanophilin Protein - (Dry Ice)

Sign In for Pricing
View Details
TYK2 Polyclonal Antibody
E-AB-93276-01 60 µL

TYK2 Polyclonal Antibody

Sign In for Pricing
View Details
TYK2 Polyclonal Antibody
E-AB-93276-02 120 µL

TYK2 Polyclonal Antibody

Sign In for Pricing
View Details