DIDO1 Peptide - N-terminal region
DIDO1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DIDO1, C20orf158, DATF1, KIAA0333
UniProt
Q9BTC0
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DIDO1 Rabbit Polyclonal Antibody (orb575306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MDDKGDPSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAEADPLEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8115844-01 0.3 mg
Influenza A H7N9 (A/Shanghai/1/2013) Hemagglutinin/HA Insect Cell Lysate (WB positive control)
Sign In for Pricing
View Details MBS8115844-02 5x 0.3 mg
Influenza A H7N9 (A/Shanghai/1/2013) Hemagglutinin/HA Insect Cell Lysate (WB positive control)
Sign In for Pricing
View Details 
LV635220 1.0 µg DNA
MYOM1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 