Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNB3 Peptide - N-terminal region

CHRNB3 Peptide - N-terminal region

Product Specifications

UniProt

Q05901

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNB3 Rabbit Polyclonal Antibody (orb324587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000740

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lymphoid tissue
CB522916 1 Block

Frozen Tissue Blocks, Lymphoid tissue

Sign In for Pricing
View Details
2-Oxo-ivabradine Hydrochloride
TRC-O856975-25MG 25 mg

2-Oxo-ivabradine Hydrochloride

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MVK (NM_000431) Human Over-expression Lysate
LC424723 20 µg

MVK (NM_000431) Human Over-expression Lysate

Sign In for Pricing
View Details
PRDX3 Polyclonal Antibody
E-AB-14313-01 20 µL

PRDX3 Polyclonal Antibody

Sign In for Pricing
View Details
PRDX3 Polyclonal Antibody
E-AB-14313-02 60 µL

PRDX3 Polyclonal Antibody

Sign In for Pricing
View Details