Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNB3 Peptide - N-terminal region

CHRNB3 Peptide - N-terminal region

Product Specifications

UniProt

Q05901

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNB3 Rabbit Polyclonal Antibody (orb324587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000740

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD2 Recombinant Rabbit Monoclonal Antibody [PSH05-85]
HA722484 100 µL

CD2 Recombinant Rabbit Monoclonal Antibody [PSH05-85]

Sign In for Pricing
View Details
PDE6D (NM_002601) Human Over-expression Lysate
LY419219 100 µg

PDE6D (NM_002601) Human Over-expression Lysate

Sign In for Pricing
View Details
OPN1MW Human Gene Knockout Kit (CRISPR)
KN419287 1 Kit

OPN1MW Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LGALS3BP Human Gene Knockout Kit (CRISPR)
KN204918LP 1 Kit

LGALS3BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S-Phenyl Benzenethiosulfonate
TRC-P319595-5G 5 g

S-Phenyl Benzenethiosulfonate

Sign In for Pricing
View Details
ALR (GFER) (C-term) Rabbit Polyclonal Antibody
AP51820PU-N 400 µL

ALR (GFER) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details