Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNC4 Peptide - N-terminal region

KCNC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KCNC4

UniProt

Q03721

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNC4 Rabbit Polyclonal Antibody (orb575389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004969

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SF20/MYDGF Antibody (1009420) [Alexa Fluor 405]
FAB1147V 0.1 mL

Mouse Monoclonal SF20/MYDGF Antibody (1009420) [Alexa Fluor 405]

Sign In for Pricing
View Details
Mmp17 (NM_001105925) Rat Tagged ORF Clone
RR206466 10 µg

Mmp17 (NM_001105925) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Cpt1b (NM_013200) Rat Tagged Lenti ORF Clone
RR203074L3 10 µg

Cpt1b (NM_013200) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Kiss1-set siRNA/shRNA/RNAi Lentivector (Rat)
25728096 4x 500 ng

Kiss1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Sodium Phosphate Buffer 0.2M, pH 7.2
41920140-3 500 mL

Sodium Phosphate Buffer 0.2M, pH 7.2

Sign In for Pricing
View Details
Histone H2B (Acetyl K20) Polyclonal Antibody, FITC Conjugated
bs-3783R-FITC 100 µL

Histone H2B (Acetyl K20) Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details