Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNC4 Peptide - N-terminal region

KCNC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KCNC4

UniProt

Q03721

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNC4 Rabbit Polyclonal Antibody (orb575389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004969

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jagged1/CD339 Polyclonal Antibody, Biotin Conjugated
bs-23033R-Biotin 100 µL

Jagged1/CD339 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Bisindolylmaleimide IV
C07296-01 5 mg

Bisindolylmaleimide IV

Sign In for Pricing
View Details
Bisindolylmaleimide IV
C07296-02 25 mg

Bisindolylmaleimide IV

Sign In for Pricing
View Details
Bhlhe40 Mouse qPCR Primer Pair (NM_011498)
MP201225 200 Reactions

Bhlhe40 Mouse qPCR Primer Pair (NM_011498)

Sign In for Pricing
View Details
18-Ethynyl-2,3,5,6,8,9,11,12,14,15-decahydrobenzo[b][1,4,7,10,13,16]hexaoxacyclooctadecine
OR1048110-01 100 mg

18-Ethynyl-2,3,5,6,8,9,11,12,14,15-decahydrobenzo[b][1,4,7,10,13,16]hexaoxacyclooctadecine

Sign In for Pricing
View Details
18-Ethynyl-2,3,5,6,8,9,11,12,14,15-decahydrobenzo[b][1,4,7,10,13,16]hexaoxacyclooctadecine
OR1048110-02 250 mg

18-Ethynyl-2,3,5,6,8,9,11,12,14,15-decahydrobenzo[b][1,4,7,10,13,16]hexaoxacyclooctadecine

Sign In for Pricing
View Details